Crystal structure of an engineered cro monomer bound nonspecifically to dna
PDB DOI: 10.2210/pdb3orc/pdb
Classification: GENE REGULATION/DNA Organism(s): Treponema Pallidum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 1998-04-23 Deposition Author(s): Albright, R.A. , Matthews, B.W. , Mossing, M.C.
Crystal structure of an engineered cro monomer bound nonspecifically to dna
Albright, R.A. , Matthews, B.W. , Mossing, M.C.
Primary Citation of Related Structures: 3ORC
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
PROTEIN (CRO REPRESSOR) | A | 65 | Treponema Pallidum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPFPSN |
Method: X-RAY DIFFRACTION
Deposited Date: 1998-04-23 Deposition Author(s): Albright, R.A. , Matthews, B.W. , Mossing, M.C.