Crystal structure of monofoil-4p homo-trimer: de novo designed monomer trefoil-fold sub-domain which forms homo-trimer assembly
PDB DOI: 10.2210/pdb3ol0/pdb
Classification: DE NOVO PROTEIN Organism(s): Synthetic Construct
Deposited: 2010-08-25 Deposition Author(s): Blaber, M. , Lee, J.
Crystal structure of monofoil-4p homo-trimer: de novo designed monomer trefoil-fold sub-domain which forms homo-trimer assembly
Primary Citation of Related Structures: 3OL0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
de novo designed monomer trefoil-fold sub-domain which forms homo-trimer assembly | A | 48 | Synthetic Construct | HHHHHHPVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEGNG |
de novo designed monomer trefoil-fold sub-domain which forms homo-trimer assembly | B | 48 | Synthetic Construct | HHHHHHPVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEGNG |
de novo designed monomer trefoil-fold sub-domain which forms homo-trimer assembly | C | 48 | Synthetic Construct | HHHHHHPVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEGNG |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-08-25 Deposition Author(s): Blaber, M. , Lee, J.