3OFW
Crystal structure of recombinant kunitz type serine protease inhibitor-1 from the carribean sea anemone stichodactyla helianthus
PDB DOI: 10.2210/pdb3ofw/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Stichodactyla Helianthus
Deposited: 2010-08-16 Deposition Author(s): Betzel, C. , De Los Angeles Chavez, M. , Garcia-Fernandez, R. , Gil, D. , Gonzalez, Y. , Perbandt, M. , Pons, T. , Redecke, L. , Talavera, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.5 Å
Crystal structure of recombinant kunitz type serine protease inhibitor-1 from the carribean sea anemone stichodactyla helianthus
Betzel, C. , De Los Angeles Chavez, M. , Garcia-Fernandez, R. , Gil, D. , Gonzalez, Y. , Perbandt, M. , Pons, T. , Redecke, L. , Talavera, A.
Primary Citation of Related Structures: 3OFW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Kunitz-type proteinase inhibitor SHPI-1 | A | 60 | Stichodactyla Helianthus | EAEASICSEPKKVGRCKGYFPRFYFDSETGKCTPFIYGGCGGNGNNFETLHQCRAICRLG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2010-08-16 Deposition Author(s): Betzel, C. , De Los Angeles Chavez, M. , Garcia-Fernandez, R. , Gil, D. , Gonzalez, Y. , Perbandt, M. , Pons, T. , Redecke, L. , Talavera, A.