Crystal structure of xanthosine phosphorylase bound with xanthine from yersinia pseudotuberculosis
PDB DOI: 10.2210/pdb3odg/pdb
Classification: TRANSFERASE Organism(s): Yersinia Pseudotuberculosis
Deposited: 2010-08-11 Deposition Author(s): Almo, S.C. , Burley, S.K. , Kim, J. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Ramagopal, U.A.
Crystal structure of xanthosine phosphorylase bound with xanthine from yersinia pseudotuberculosis
Almo, S.C. , Burley, S.K. , Kim, J. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Ramagopal, U.A.
Primary Citation of Related Structures: 3ODG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Xanthosine phosphorylase | A | 287 | Yersinia Pseudotuberculosis | MTTVNSNINVDADFNELPFQAVKYIQKIKPGFKPQIAFILGSGLGDLVDQITNDTTISYADIPGFPVSSVHGHAGELVLGDLCGVPVMCMKGRGHFYEGKGMSIMTNPVRTFKLMGCEFLFCTNAAGSLRPEVLPGSVVMLKDHINTMPGTPLVGPNDDRFGPRFFSLANAYDKDLRADMAKIAQQLDIPLTEGVFVSYPGPCFETPAEIRMMQIIGGDVVGMSVVPEVLSAAHCGLKVIALTAITNLAEGLSDVVLSHEQTLKFAKVASVNFTKLIEAFLKSKALR |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-08-11 Deposition Author(s): Almo, S.C. , Burley, S.K. , Kim, J. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Ramagopal, U.A.