Crystal structure of the tsg101 uev domain in complex with a human hrs psap peptide
PDB DOI: 10.2210/pdb3obq/pdb
Classification: PROTEIN TRANSPORT Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2010-08-09 Deposition Author(s): Hurley, J.H. , Im, Y.J.
Crystal structure of the tsg101 uev domain in complex with a human hrs psap peptide
Primary Citation of Related Structures: 3OBQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tumor susceptibility gene 101 protein | A | 146 | Homo Sapiens , Synthetic Construct | GAMGSAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYGTGSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP |
| Hepatocyte growth factor-regulated tyrosine kinase substrate | B | 9 | Homo Sapiens , Synthetic Construct | PTPSAPVPL |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-08-09 Deposition Author(s): Hurley, J.H. , Im, Y.J.