Crystal structure of the ran binding domain from the nuclear complex component nup2 from ashbya gossypii
PDB DOI: 10.2210/pdb3oan/pdb
Classification: TRANSPORT PROTEIN Organism(s): Ashbya Gossypii
Deposited: 2010-08-05 Deposition Author(s): Almo, S.C. , Burley, S.K. , Malashkevich, V.N. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Sauder, J.M. , Toro, R.
Crystal structure of the ran binding domain from the nuclear complex component nup2 from ashbya gossypii
Almo, S.C. , Burley, S.K. , Malashkevich, V.N. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Sauder, J.M. , Toro, R.
Primary Citation of Related Structures: 3OAN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ABR034Wp | A | 130 | Ashbya Gossypii | MSLTNGEENEEVLFCEKAKLLIFDSDTKGYTSRGVGELKLLRKKDDKGKVRVLMRSEGMGHVLLNTSVVKSFKYQPIDADNENLIKWPIITDGKLETFIIKVKQKADGRRLVGAVADAQQAMEGHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-08-05 Deposition Author(s): Almo, S.C. , Burley, S.K. , Malashkevich, V.N. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Sauder, J.M. , Toro, R.