Conformational plasticity of p38 map kinase dfg-motif mutants in response to inhibitor binding
PDB DOI: 10.2210/pdb3o8t/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2010-08-03 Deposition Author(s): Bukhtiyarova, M. , Karpusas, M. , Namboodiri, H.V. , Springman, E.B.
Conformational plasticity of p38 map kinase dfg-motif mutants in response to inhibitor binding
Bukhtiyarova, M. , Karpusas, M. , Namboodiri, H.V. , Springman, E.B.
Primary Citation of Related Structures: 3O8T
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mitogen-activated protein kinase 14 | A | 360 | Homo Sapiens | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDAGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-08-03 Deposition Author(s): Bukhtiyarova, M. , Karpusas, M. , Namboodiri, H.V. , Springman, E.B.