3O7A
Crystal structure of phf13 in complex with h3k4me3
PDB DOI: 10.2210/pdb3o7a/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2010-07-30 Deposition Author(s): Arrowsmith, C.H. , Bian, C.B. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Lam, R. , Min, J. , Structural Genomics Consortium (Sgc) , Weigelt, J. , Xu, C.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.67 Å
Crystal structure of phf13 in complex with h3k4me3
Arrowsmith, C.H. , Bian, C.B. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Lam, R. , Min, J. , Structural Genomics Consortium (Sgc) , Weigelt, J. , Xu, C.
Primary Citation of Related Structures: 3O7A
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PHD finger protein 13 variant | A | 52 | Homo Sapiens , Synthetic Construct | SWDLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDS |
| H3K4ME3 HISTONE 11MER-PEPTIDE | B | 11 | Homo Sapiens , Synthetic Construct | ARTKQTARKST |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2010-07-30 Deposition Author(s): Arrowsmith, C.H. , Bian, C.B. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Lam, R. , Min, J. , Structural Genomics Consortium (Sgc) , Weigelt, J. , Xu, C.