Crystal structure of the n-terminal domain of dna-binding protein satb1 from homo sapiens, northeast structural genomics consortium target hr4435b
PDB DOI: 10.2210/pdb3nzl/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2010-07-16 Deposition Author(s): Abashidze, M. , Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Forouhar, F. , Hunt, J.F. , Kuzin, A.P. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Patel, P. , Rost, B. , Seetharaman, J. , Shastry, R. , Tong, L. , Xiao, R.
Crystal structure of the n-terminal domain of dna-binding protein satb1 from homo sapiens, northeast structural genomics consortium target hr4435b
Abashidze, M. , Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Forouhar, F. , Hunt, J.F. , Kuzin, A.P. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Patel, P. , Rost, B. , Seetharaman, J. , Shastry, R. , Tong, L. , Xiao, R.
Primary Citation of Related Structures: 3NZL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA-binding protein SATB1 | A | 83 | Homo Sapiens | MGHHHHHHSHMLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFKKTKDMM |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-07-16 Deposition Author(s): Abashidze, M. , Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Forouhar, F. , Hunt, J.F. , Kuzin, A.P. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Patel, P. , Rost, B. , Seetharaman, J. , Shastry, R. , Tong, L. , Xiao, R.