Structure of the mlle domain of edd in complex with a pam2 peptide from paip1
PDB DOI: 10.2210/pdb3ntw/pdb
Classification: PROTEIN BINDING Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2010-07-05 Deposition Author(s): Gehring, K. , Kozlov, G.
Method: X-RAY DIFFRACTION Resolution: 2.6 Å
Structure of the mlle domain of edd in complex with a pam2 peptide from paip1
Primary Citation of Related Structures: 3NTW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase UBR5 | A | 65 | Rattus Norvegicus , Synthetic Construct | GPLGSHRQALGERLYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVEEAMELIVAH |
E3 ubiquitin-protein ligase UBR5 | C | 65 | Rattus Norvegicus , Synthetic Construct | GPLGSHRQALGERLYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVEEAMELIVAH |
Polyadenylate-binding protein-interacting protein 1 | B | 22 | Rattus Norvegicus , Synthetic Construct | VLMSKLSVNAPEFYPSGYSSSY |
Polyadenylate-binding protein-interacting protein 1 | D | 22 | Rattus Norvegicus , Synthetic Construct | VLMSKLSVNAPEFYPSGYSSSY |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-07-05 Deposition Author(s): Gehring, K. , Kozlov, G.