Crystal structure of the cugbp1 rrm1 with guuguuuuguuu rna
PDB DOI: 10.2210/pdb3nnh/pdb
Classification: RNA BINDING PROTEIN/RNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-06-23 Deposition Author(s): Gaw, H. , Patel, D.J. , Song, J. , Teplov, A. , Teplova, M.
Crystal structure of the cugbp1 rrm1 with guuguuuuguuu rna
Gaw, H. , Patel, D.J. , Song, J. , Teplov, A. , Teplova, M.
Primary Citation of Related Structures: 3NNH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
CUGBP Elav-like family member 1 | A | 88 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE |
CUGBP Elav-like family member 1 | C | 88 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE |
CUGBP Elav-like family member 1 | B | 88 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE |
CUGBP Elav-like family member 1 | D | 88 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-06-23 Deposition Author(s): Gaw, H. , Patel, D.J. , Song, J. , Teplov, A. , Teplova, M.