Crystal structure of pfc0360w, an hsp90 activator from plasmodium falciparum
PDB DOI: 10.2210/pdb3ni8/pdb
Classification: UNKNOWN FUNCTION Organism(s): Plasmodium Falciparum
Deposited: 2010-06-15 Deposition Author(s): Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Cossar, D. , Edwards, A.M. , Hills, T. , Hui, R. , Hutchinson, A. , Kozieradzki, I. , Mackenzie, F. , Pizzaro, J.C. , Structural Genomics Consortium (Sgc) , Sullivan, H. , Weigelt, J. , Wernimont, A.K.
Crystal structure of pfc0360w, an hsp90 activator from plasmodium falciparum
Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Cossar, D. , Edwards, A.M. , Hills, T. , Hui, R. , Hutchinson, A. , Kozieradzki, I. , Mackenzie, F. , Pizzaro, J.C. , Structural Genomics Consortium (Sgc) , Sullivan, H. , Weigelt, J. , Wernimont, A.K.
Primary Citation of Related Structures: 3NI8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PFC0360w protein | A | 158 | Plasmodium Falciparum | MHHHHHHSSGRENLYFQGMSFEITEEYYVPPEVLFNAFTDAYTLTRLSRGSLAEVDLKVGGKFSLFSGSILGEFTEITKPHKIVEKWKFRDWNECDYSTVTVEFISVKENHTKLKLTHNNIPASNKYNEGGVLERCKNGWTQNFLHNIEVILGYPKKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-06-15 Deposition Author(s): Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Cossar, D. , Edwards, A.M. , Hills, T. , Hui, R. , Hutchinson, A. , Kozieradzki, I. , Mackenzie, F. , Pizzaro, J.C. , Structural Genomics Consortium (Sgc) , Sullivan, H. , Weigelt, J. , Wernimont, A.K.