Rna polymerase alpha c-terminal domain (e. coli) and sigma region 4 (t. aq. mutant) bound to (up,-35 element) dna
PDB DOI: 10.2210/pdb3n97/pdb
Classification: GENE REGULATION/DNA Organism(s): Escherichia Coli , Thermus Aquaticus , Synthetic Construct
Deposited: 2010-05-28 Deposition Author(s): Birktoft, J.J. , Lara-Gonzalez, S. , Lawson, C.L.
Method: X-RAY DIFFRACTION Resolution: 3.252 Å
Rna polymerase alpha c-terminal domain (e. coli) and sigma region 4 (t. aq. mutant) bound to (up,-35 element) dna
Birktoft, J.J. , Lara-Gonzalez, S. , Lawson, C.L.
Primary Citation of Related Structures: 3N97
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
RNA polymerase sigma factor | A | 72 | Escherichia Coli , Thermus Aquaticus , Synthetic Construct | SEELEKALSKLSEREAMVLKMRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLRHPSRSEKLRDFLE |
RNA polymerase sigma factor | D | 72 | Escherichia Coli , Thermus Aquaticus , Synthetic Construct | SEELEKALSKLSEREAMVLKMRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLRHPSRSEKLRDFLE |
DNA-directed RNA polymerase subunit alpha | B | 84 | Escherichia Coli , Thermus Aquaticus , Synthetic Construct | KPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE |
DNA-directed RNA polymerase subunit alpha | C | 84 | Escherichia Coli , Thermus Aquaticus , Synthetic Construct | KPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-05-28 Deposition Author(s): Birktoft, J.J. , Lara-Gonzalez, S. , Lawson, C.L.