Crystal structure of a putative glutathionylspermidine synthase (mfla_0391) from methylobacillus flagellatus kt at 2.35 a resolution
PDB DOI: 10.2210/pdb3n6x/pdb
Classification: LIGASE Organism(s): Methylobacillus Flagellatus
Deposited: 2010-05-26 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of a putative glutathionylspermidine synthase (mfla_0391) from methylobacillus flagellatus kt at 2.35 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 3N6X
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative glutathionylspermidine synthase | A | 474 | Methylobacillus Flagellatus | GMDTAKTKPFDEMFLQDEVIRPIYAEYAAWLQDVPHQQLESKRQEAELLFRRVGITFNVYGEDAGAERLIPFDVVPRILSASEWARLSDGAIQRVKALNMFLHDVYHDQEIIKAGIVPSSILANAQYRPEMFGVDVPGGVYAHIAGVDLVRTGENDFYVLEDNLRTPSGVSYMLENRKMMMRLFPELFRRYPVAPVEHYPQVLLNNLRAVAQAGVHEPTVVLLTPGAYNSAYFEHAFIAQQMGIELVEGQDLFVRNNAVYMRTTEGPKRVDVIYRRIDDDFIDPLSFRPDSMLGVPGLLSVYRNGGVTLANAVGTGVADDKDTYIYVPEMIRFYLGEEPILSNVPTYQLSKADDLKYVLDNLAELVVKEVQGSGGYGMLVGPAASKQELEDFRQRILANPANYIAQPTLALSTCPTLVETGIAPRHVDLRPFVLSGKTVSLVPGALCRVALREGSLVVNSSQGGGTKDTWILKD |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-05-26 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)