Crystal structure of the c92u mutant c-di-gmp riboswith bound to c-di-gmp
PDB DOI: 10.2210/pdb3mur/pdb
Classification: RNA binding PROTEIN/RNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2010-05-03 Deposition Author(s): Smith, K.D. , Strobel, S.A.
Crystal structure of the c92u mutant c-di-gmp riboswith bound to c-di-gmp
Primary Citation of Related Structures: 3MUR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| U1 small nuclear ribonucleoprotein A | P | 98 | Homo Sapiens , Synthetic Construct | MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| C92U mutant c-di-GMP riboswitch | r | 92 | NA | GGUCACGCACAGGGCAAACCAUUCGAAAGAGUGGGACGCAAAGCCUCCGGCCUAAACCAUUGCACUCCGGUAGGUAGCGGGGUUAUCGAUGG |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-05-03 Deposition Author(s): Smith, K.D. , Strobel, S.A.