Crystal structure of the usp7:hdm2(psts) complex
PDB DOI: 10.2210/pdb3mqs/pdb
Classification: HYDROLASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-04-28 Deposition Author(s): Saridakis, V.
Method: X-RAY DIFFRACTION Resolution: 2.4 Å
Crystal structure of the usp7:hdm2(psts) complex
Primary Citation of Related Structures: 3MQS
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ubiquitin carboxyl-terminal hydrolase 7 | C | 155 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW |
Hdm2 peptide | D | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | YSQPSTSSSI |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-04-28 Deposition Author(s): Saridakis, V.