3MAZ
Crystal structure of the human brdg1/stap-1 sh2 domain in complex with the ntal ptyr136 peptide
PDB DOI: 10.2210/pdb3maz/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-03-24 Deposition Author(s): Huang, H. , Kaneko, T. , Li, L. , Li, S.S. , Liu, H. , Schiller, M.R. , Voss, C.K. , Wu, C. , Zhao, B.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Crystal structure of the human brdg1/stap-1 sh2 domain in complex with the ntal ptyr136 peptide
Huang, H. , Kaneko, T. , Li, L. , Li, S.S. , Liu, H. , Schiller, M.R. , Voss, C.K. , Wu, C. , Zhao, B.
Primary Citation of Related Structures: 3MAZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Signal-transducing adaptor protein 1 | A | 125 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSGRAMDYVDVLNPMPACFYTVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFIASTDENTGQEPSMEGRS |
| CheD family protein | B | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ANSYENVLIAKX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2010-03-24 Deposition Author(s): Huang, H. , Kaneko, T. , Li, L. , Li, S.S. , Liu, H. , Schiller, M.R. , Voss, C.K. , Wu, C. , Zhao, B.