Crystal structure of the amino terminal coiled coil domain of the mycobacterium tuberculosis proteasomal atpase mpa
PDB DOI: 10.2210/pdb3m9h/pdb
Classification: CHAPERONE Organism(s): Mycobacterium Tuberculosis
Deposited: 2010-03-22 Deposition Author(s): Li, H. , Wang, T.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proteasome-associated ATPase | A | 55 | Mycobacterium Tuberculosis | GSHMSHAPTRSARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQ |
Proteasome-associated ATPase | B | 55 | Mycobacterium Tuberculosis | GSHMSHAPTRSARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQ |
Proteasome-associated ATPase | C | 55 | Mycobacterium Tuberculosis | GSHMSHAPTRSARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQ |
Proteasome-associated ATPase | D | 55 | Mycobacterium Tuberculosis | GSHMSHAPTRSARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQ |
Proteasome-associated ATPase | E | 55 | Mycobacterium Tuberculosis | GSHMSHAPTRSARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQ |
Proteasome-associated ATPase | F | 55 | Mycobacterium Tuberculosis | GSHMSHAPTRSARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQ |
Method: X-RAY DIFFRACTION