Crystal structure of the prokaryotic ubiquitin-like protein (pup) complexed with the amino terminal coiled coil of the mycobacterium tuberculosis proteasomal atpase mpa
PDB DOI: 10.2210/pdb3m91/pdb
Classification: HYDROLASE REGULATOR Organism(s): Mycobacterium Tuberculosis
Deposited: 2010-03-19 Deposition Author(s): Li, H. , Wang, T.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proteasome-associated ATPase | A | 51 | Mycobacterium Tuberculosis | SHAPTRSARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQ |
| Proteasome-associated ATPase | C | 51 | Mycobacterium Tuberculosis | SHAPTRSARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQ |
| Prokaryotic ubiquitin-like protein pup | B | 44 | Mycobacterium Tuberculosis | STAAGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQKGGE |
| Prokaryotic ubiquitin-like protein pup | D | 44 | Mycobacterium Tuberculosis | STAAGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQKGGE |
Method: X-RAY DIFFRACTION