Crystal structure of paci-dna enzyme product complex
PDB DOI: 10.2210/pdb3m7k/pdb
Classification: HYDROLASE/DNA Organism(s): Fontimonas Thermophila , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-03-16 Deposition Author(s): Shen, B.W. , Stoddard, B.L.
Crystal structure of paci-dna enzyme product complex
Primary Citation of Related Structures: 3M7K
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
restriction endonuclease PacI | A | 142 | Fontimonas Thermophila , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MTQCPRCQRNLAADEFYAGSSKMCKGCMTWQNLSYNANKEGHANTFTKATFLAWYGLSAQRHCGYCGISEAGFTSLHRTNPRGYHIQCLGVDRSDSFEGYSPQNARLACFICNRIKSNIFSASEMDVLGEAISKAWHGRGIA |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-03-16 Deposition Author(s): Shen, B.W. , Stoddard, B.L.