The roles of glutamates and metal ions in a rationally designed nitric oxide reductase based on myoglobin: cu(ii)-i107e febmb (cu(ii) binding to feb site)
PDB DOI: 10.2210/pdb3m3a/pdb
Classification: OXYGEN TRANSPORT Organism(s): Physeter Catodon
Deposited: 2010-03-08 Deposition Author(s): Gao, Y.-G. , Lin, Y.-W. , Lu, Y. , Miner, K.D. , Robinson, H. , Tian, S. , Yeung, N.
The roles of glutamates and metal ions in a rationally designed nitric oxide reductase based on myoglobin: cu(ii)-i107e febmb (cu(ii) binding to feb site)
Gao, Y.-G. , Lin, Y.-W. , Lu, Y. , Miner, K.D. , Robinson, H. , Tian, S. , Yeung, N.
Primary Citation of Related Structures: 3M3A
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myoglobin | A | 153 | Physeter Catodon | VLSEGEWQLVLHVWAKVEADVAGHGQDIHIRLFKSHPETLEKHDRFKHLKTEAEMKASEDLKKHGVTELTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFESEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-03-08 Deposition Author(s): Gao, Y.-G. , Lin, Y.-W. , Lu, Y. , Miner, K.D. , Robinson, H. , Tian, S. , Yeung, N.