Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 5.
PDB DOI: 10.2210/pdb3m0q/pdb
Classification: SIGNALING PROTEIN Organism(s): Gallus Gallus
Deposited: 2010-03-03 Deposition Author(s): Camara-Artigas, A. , Gavira, J.A.
Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 5.
Camara-Artigas, A. , Gavira, J.A.
Primary Citation of Related Structures: 3M0Q
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Spectrin alpha chain, brain | A | 62 | Gallus Gallus | MDETGKELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-03-03 Deposition Author(s): Camara-Artigas, A. , Gavira, J.A.