Crystal structure of hiv-1 crf01_ae protease in complex with darunavir
PDB DOI: 10.2210/pdb3lzs/pdb
Classification: HYDROLASE Organism(s): Human Immunodeficiency Virus 1
Deposited: 2010-03-01 Deposition Author(s): Bandaranayake, R.M. , Schiffer, C.A.
Crystal structure of hiv-1 crf01_ae protease in complex with darunavir
Bandaranayake, R.M. , Schiffer, C.A.
Primary Citation of Related Structures: 3LZS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 protease | A | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF |
| HIV-1 protease | B | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-03-01 Deposition Author(s): Bandaranayake, R.M. , Schiffer, C.A.