X-ray structure of a non-biological atp binding protein determined in the presence of 10 mm atp at 2.6 a after 3 weeks of incubation
PDB DOI: 10.2210/pdb3ltb/pdb
Classification: DE NOVO PROTEIN Organism(s): Synthetic Construct
Deposited: 2010-02-15 Deposition Author(s): Allen, J.P. , Chaput, J.C. , Magee, C.L. , Simmons, C.R.
Method: X-RAY DIFFRACTION Resolution: 2.6 Å
X-ray structure of a non-biological atp binding protein determined in the presence of 10 mm atp at 2.6 a after 3 weeks of incubation
Allen, J.P. , Chaput, J.C. , Magee, C.L. , Simmons, C.R.
Primary Citation of Related Structures: 3LTB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ATP BINDING PROTEIN-DX | A | 81 | Synthetic Construct | GSMDYKDDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADSKEISNT |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-02-15 Deposition Author(s): Allen, J.P. , Chaput, J.C. , Magee, C.L. , Simmons, C.R.