Crystal structure of human alpha-defensin 1 (y16a mutant)
PDB DOI: 10.2210/pdb3lo1/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): N.A.
Deposited: 2010-02-03 Deposition Author(s): Lu, W. , Pazgier, M.
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Crystal structure of human alpha-defensin 1 (y16a mutant)
Primary Citation of Related Structures: 3LO1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Neutrophil defensin 1 | A | 30 | N.A. | ACYCRIPACIAGERRAGTCIYQGRLWAFCC |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-02-03 Deposition Author(s): Lu, W. , Pazgier, M.