3LGL
Crystal structure of the 53bp1 tandem tudor domain in complex with p53k382me2
PDB DOI: 10.2210/pdb3lgl/pdb
Classification: CELL CYCLE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-01-20 Deposition Author(s): Kutateladze, T.G. , Roy, S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Crystal structure of the 53bp1 tandem tudor domain in complex with p53k382me2
Primary Citation of Related Structures: 3LGL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tumor suppressor p53-binding protein 1 | A | 125 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG |
| DIMETHYLATED p53 LYSINE 382 PEPTIDE | B | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TSRHKKLMFKT |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2010-01-20 Deposition Author(s): Kutateladze, T.G. , Roy, S.