Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.70 angstrom resolution in complex with 2-(2-((benzofuran-2-carboxamido)methyl)-5-methoxy-1h-indol-1-yl)acetic acid
PDB DOI: 10.2210/pdb3le8/pdb
Classification: LIGASE Organism(s): Mycobacterium Tuberculosis
Deposited: 2010-01-14 Deposition Author(s): Abell, C. , Blundell, T.L. , Ciulli, A. , Hung, A.W. , Silvestre, H.L. , Sledz, P.
Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.70 angstrom resolution in complex with 2-(2-((benzofuran-2-carboxamido)methyl)-5-methoxy-1h-indol-1-yl)acetic acid
Abell, C. , Blundell, T.L. , Ciulli, A. , Hung, A.W. , Silvestre, H.L. , Sledz, P.
Primary Citation of Related Structures: 3LE8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Pantothenate synthetase | A | 300 | Mycobacterium Tuberculosis | MAIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYR |
| Pantothenate synthetase | B | 300 | Mycobacterium Tuberculosis | MAIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYR |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-01-14 Deposition Author(s): Abell, C. , Blundell, T.L. , Ciulli, A. , Hung, A.W. , Silvestre, H.L. , Sledz, P.