B.licheniformis anti-trap can assemble into two types of dodecameric particles with the same symmetry but inverted orientation of trimers
PDB DOI: 10.2210/pdb3lcz/pdb
Classification: GENE REGULATION Organism(s): Bacillus Licheniformis
Deposited: 2010-01-12 Deposition Author(s): Antson, A.A. , Chen, Y. , Gollnick, P. , Shevtsov, M.B.
Method: X-RAY DIFFRACTION Resolution: 2.06 Å
B.licheniformis anti-trap can assemble into two types of dodecameric particles with the same symmetry but inverted orientation of trimers
Antson, A.A. , Chen, Y. , Gollnick, P. , Shevtsov, M.B.
Primary Citation of Related Structures: 3LCZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Inhibitor of TRAP, regulated by T-BOX (Trp) sequence RtpA | A | 53 | Bacillus Licheniformis | MVIATDDLETTCPNCNGSGREEPEPCPKCLGKGVILTAQGSTLLHFIKKHIHE |
Inhibitor of TRAP, regulated by T-BOX (Trp) sequence RtpA | B | 53 | Bacillus Licheniformis | MVIATDDLETTCPNCNGSGREEPEPCPKCLGKGVILTAQGSTLLHFIKKHIHE |
Inhibitor of TRAP, regulated by T-BOX (Trp) sequence RtpA | C | 53 | Bacillus Licheniformis | MVIATDDLETTCPNCNGSGREEPEPCPKCLGKGVILTAQGSTLLHFIKKHIHE |
Inhibitor of TRAP, regulated by T-BOX (Trp) sequence RtpA | D | 53 | Bacillus Licheniformis | MVIATDDLETTCPNCNGSGREEPEPCPKCLGKGVILTAQGSTLLHFIKKHIHE |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-01-12 Deposition Author(s): Antson, A.A. , Chen, Y. , Gollnick, P. , Shevtsov, M.B.