PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

3LCZ

B.licheniformis anti-trap can assemble into two types of dodecameric particles with the same symmetry but inverted orientation of trimers

PDB DOI: 10.2210/pdb3lcz/pdb

Classification: GENE REGULATION
Organism(s): Bacillus Licheniformis

Deposited: 2010-01-12
Deposition Author(s): Antson, A.A. , Chen, Y. , Gollnick, P. , Shevtsov, M.B.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 2.06 Å

3lcz
Literature

B.licheniformis anti-trap can assemble into two types of dodecameric particles with the same symmetry but inverted orientation of trimers

Antson, A.A. , Chen, Y. , Gollnick, P. , Shevtsov, M.B.

Primary Citation of Related Structures: 3LCZ


Proteins
Molecule Chains Sequence Length Organism Sequence
Inhibitor of TRAP, regulated by T-BOX (Trp) sequence RtpA A 53 Bacillus Licheniformis MVIATDDLETTCPNCNGSGREEPEPCPKCLGKGVILTAQGSTLLHFIKKHIHE
Inhibitor of TRAP, regulated by T-BOX (Trp) sequence RtpA B 53 Bacillus Licheniformis MVIATDDLETTCPNCNGSGREEPEPCPKCLGKGVILTAQGSTLLHFIKKHIHE
Inhibitor of TRAP, regulated by T-BOX (Trp) sequence RtpA C 53 Bacillus Licheniformis MVIATDDLETTCPNCNGSGREEPEPCPKCLGKGVILTAQGSTLLHFIKKHIHE
Inhibitor of TRAP, regulated by T-BOX (Trp) sequence RtpA D 53 Bacillus Licheniformis MVIATDDLETTCPNCNGSGREEPEPCPKCLGKGVILTAQGSTLLHFIKKHIHE
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2010-01-12
Deposition Author(s): Antson, A.A. , Chen, Y. , Gollnick, P. , Shevtsov, M.B.