Inhibitor bound to a dfg-in structure of the kinase domain of csf-1r
PDB DOI: 10.2210/pdb3lcd/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2010-01-10 Deposition Author(s): Day, J.E. , Kamtekar, S. , Mathis, K.J. , Meyers, M.J. , Reitz, B.A.
Method: X-RAY DIFFRACTION Resolution: 2.5 Å
Inhibitor bound to a dfg-in structure of the kinase domain of csf-1r
Day, J.E. , Kamtekar, S. , Mathis, K.J. , Meyers, M.J. , Reitz, B.A.
Primary Citation of Related Structures: 3LCD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Macrophage colony-stimulating factor 1 receptor | A | 329 | Homo Sapiens | GVDYKYKQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEADLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQAQEDRRERD |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-01-10 Deposition Author(s): Day, J.E. , Kamtekar, S. , Mathis, K.J. , Meyers, M.J. , Reitz, B.A.