Crystal structure of reston ebola vp35 interferon inhibitory domain
PDB DOI: 10.2210/pdb3l2a/pdb
Classification: RNA BINDING PROTEIN Organism(s): Reston Ebolavirus
Deposited: 2009-12-14 Deposition Author(s): Amarasinghe, G.K. , Basler, C.F. , Borek, D.M. , Farahbakhsh, M. , Leung, D.W. , Prins, K.C.
Crystal structure of reston ebola vp35 interferon inhibitory domain
Amarasinghe, G.K. , Basler, C.F. , Borek, D.M. , Farahbakhsh, M. , Leung, D.W. , Prins, K.C.
Primary Citation of Related Structures: 3L2A
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Polymerase cofactor VP35 | A | 129 | Reston Ebolavirus | GHMGKPYISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-12-14 Deposition Author(s): Amarasinghe, G.K. , Basler, C.F. , Borek, D.M. , Farahbakhsh, M. , Leung, D.W. , Prins, K.C.