Crystal structure of u-box domain of human e4b ubiquitin ligase
PDB DOI: 10.2210/pdb3l1x/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2009-12-14 Deposition Author(s): Benirschke, R. , Mer, G. , Thompson, J.R.
Crystal structure of u-box domain of human e4b ubiquitin ligase
Benirschke, R. , Mer, G. , Thompson, J.R.
Primary Citation of Related Structures: 3L1X
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ubiquitin conjugation factor E4 B | A | 100 | Homo Sapiens | GSHKFAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-12-14 Deposition Author(s): Benirschke, R. , Mer, G. , Thompson, J.R.