Solution structure of the respiratory syncytial virus (rsv)six-helix bundle complexed with tmc353121, a small-moleucule inhibitor of rsv
PDB DOI: 10.2210/pdb3kpe/pdb
Classification: VIRAL PROTEIN, FUSION PROTEIN Organism(s): Human Respiratory Syncytial Virus
Deposited: 2009-11-16 Deposition Author(s): Andries, K. , Arnoult, E. , Cummings, M.D. , De Bondt, H. , Roymans, D. , Van Vlijmen, H.
Solution structure of the respiratory syncytial virus (rsv)six-helix bundle complexed with tmc353121, a small-moleucule inhibitor of rsv
Andries, K. , Arnoult, E. , Cummings, M.D. , De Bondt, H. , Roymans, D. , Van Vlijmen, H.
Primary Citation of Related Structures: 3KPE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fusion glycoprotein F0 | A | 51 | Human Respiratory Syncytial Virus | HLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNK |
| Fusion glycoprotein F0 | B | 39 | Human Respiratory Syncytial Virus | VFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGK |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-11-16 Deposition Author(s): Andries, K. , Arnoult, E. , Cummings, M.D. , De Bondt, H. , Roymans, D. , Van Vlijmen, H.