3KFO
Crystal structure of the c-terminal domain from the nuclear pore complex component nup133 from saccharomyces cerevisiae
PDB DOI: 10.2210/pdb3kfo/pdb
Classification: PROTEIN TRANSPORT Organism(s): Saccharomyces Cerevisiae
Deposited: 2009-10-27 Deposition Author(s): Almo, S.C. , Atwell, S. , Bain, K. , Bonanno, J.B. , Burley, S.K. , Dickey, M. , Emtage, J.S. , Fernandez-Martinez, J. , Franke, J.D. , Gheyi, T. , Miller, S. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Phillips, J. , Pieper, U. , Rout, M. , Sali, A. , Sampathkumar, P. , Sauder, J.M. , Thompson, D.A. , Wasserman, S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Crystal structure of the c-terminal domain from the nuclear pore complex component nup133 from saccharomyces cerevisiae
Almo, S.C. , Atwell, S. , Bain, K. , Bonanno, J.B. , Burley, S.K. , Dickey, M. , Emtage, J.S. , Fernandez-Martinez, J. , Franke, J.D. , Gheyi, T. , Miller, S. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Phillips, J. , Pieper, U. , Rout, M. , Sali, A. , Sampathkumar, P. , Sauder, J.M. , Thompson, D.A. , Wasserman, S.
Primary Citation of Related Structures: 3KFO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nucleoporin NUP133 | A | 288 | Saccharomyces Cerevisiae | MSLKYGHVAWIQQILDGSYADAMNTLKNITVDDSKKGESLSECELHLNVAKLSSLLVEKDNLDINTLRKIQYNLDTIDAEKNISNKLKKGEVQICKRFKNGSIREVFNILVEELKSTTVVNLSDLVELYSMLDDEESLFIPLRLLSVDGNLLNFEVKKFLNALVWRRIVLLNASNEGDKLLQHIVKRVFDEELPKNNDFPLPSVDLLCDKSLLTPEYISETYGRFPIDQNAIREEIYEEISQVETLNSDNSLEIKLHSTIGSVAKEKNYTINYETNTVEYEGHHHHHH |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2009-10-27 Deposition Author(s): Almo, S.C. , Atwell, S. , Bain, K. , Bonanno, J.B. , Burley, S.K. , Dickey, M. , Emtage, J.S. , Fernandez-Martinez, J. , Franke, J.D. , Gheyi, T. , Miller, S. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Phillips, J. , Pieper, U. , Rout, M. , Sali, A. , Sampathkumar, P. , Sauder, J.M. , Thompson, D.A. , Wasserman, S.