Advanced Search:
3KA5
Crystal structure of ribosome-associated protein y (psrp-1) from clostridium acetobutylicum. northeast structural genomics consortium target id car123a
PDB DOI: 10.2210/pdb3ka5/pdb
Classification: CHAPERONE Organism(s): Clostridium Acetobutylicum
Deposited: 2009-10-18 Deposition Author(s): Acton, T.B. , Baran, M.C. , Cunningham, K. , Hunt, J.F. , Janjua, H. , Liu, J. , Montelione, G.T. , Neely, H. , Northeast Structural Genomics Consortium (Nesg) , Owens, L. , Rost, B. , Seetharaman, J. , Tong, L. , Wang, D. , Xiao, R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Crystal structure of ribosome-associated protein y (psrp-1) from clostridium acetobutylicum. northeast structural genomics consortium target id car123a
Acton, T.B. , Baran, M.C. , Cunningham, K. , Hunt, J.F. , Janjua, H. , Liu, J. , Montelione, G.T. , Neely, H. , Northeast Structural Genomics Consortium (Nesg) , Owens, L. , Rost, B. , Seetharaman, J. , Tong, L. , Wang, D. , Xiao, R.
Primary Citation of Related Structures: 3KA5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ribosome-associated protein Y (PSrp-1) | A | 65 | Clostridium Acetobutylicum | EIVKTKRFAIKPMSEEEAVLEMELLGHNFFVFQNGDSNEVNVVYKRKDGNYGLIEPELEHHHHHH |
| Ribosome-associated protein Y (PSrp-1) | B | 65 | Clostridium Acetobutylicum | EIVKTKRFAIKPMSEEEAVLEMELLGHNFFVFQNGDSNEVNVVYKRKDGNYGLIEPELEHHHHHH |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2009-10-18 Deposition Author(s): Acton, T.B. , Baran, M.C. , Cunningham, K. , Hunt, J.F. , Janjua, H. , Liu, J. , Montelione, G.T. , Neely, H. , Northeast Structural Genomics Consortium (Nesg) , Owens, L. , Rost, B. , Seetharaman, J. , Tong, L. , Wang, D. , Xiao, R.