Crystal structure of chemically synthesized 203 amino acid 'covalent dimer' [l-ala;gly51']hiv-1 protease molecule complexed with mvt-101 reduced isostere inhibitor at 1.4 a resolution
PDB DOI: 10.2210/pdb3ka2/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): N.A.
Deposited: 2009-10-18 Deposition Author(s): Kent, S.B.H. , Torbeev, V.Y.
Crystal structure of chemically synthesized 203 amino acid 'covalent dimer' [l-ala;gly51']hiv-1 protease molecule complexed with mvt-101 reduced isostere inhibitor at 1.4 a resolution
Primary Citation of Related Structures: 3KA2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| [L-Ala51;Gly51']HIV-1 protease | A | 203 | N.A. | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEELNLPGCWKPKLIGGIAGFIKVRQYDQIPVEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNFCGGGGPQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEELNLPGCWKPKLIGGIGGFIKVRQYDQIPVEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-10-18 Deposition Author(s): Kent, S.B.H. , Torbeev, V.Y.