Advanced Search:
3K6T
Crystal structure of the gld-1 homodimerization domain from caenorhabditis elegans at 2.04 a resolution
PDB DOI: 10.2210/pdb3k6t/pdb
Classification: PROTEIN BINDING Organism(s): Caenorhabditis Elegans
Deposited: 2009-10-09 Deposition Author(s): Beuck, C. , Carmel, A.B. , Columbus, L. , Kerkow, D.E. , Stanfield, R.L. , Szymczyna, B.R. , Williamson, J.R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.04 Å
Crystal structure of the gld-1 homodimerization domain from caenorhabditis elegans at 2.04 a resolution
Beuck, C. , Carmel, A.B. , Columbus, L. , Kerkow, D.E. , Stanfield, R.L. , Szymczyna, B.R. , Williamson, J.R.
Primary Citation of Related Structures: 3K6T
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Female germline-specific tumor suppressor gld-1 | A | 60 | Caenorhabditis Elegans | GSHEATVEYLADLVKEKKHLTLFPHMFSNVERLLDDEIGRVRVALFQTEFPRVELPEPAG |
| Female germline-specific tumor suppressor gld-1 | B | 60 | Caenorhabditis Elegans | GSHEATVEYLADLVKEKKHLTLFPHMFSNVERLLDDEIGRVRVALFQTEFPRVELPEPAG |
| Female germline-specific tumor suppressor gld-1 | C | 60 | Caenorhabditis Elegans | GSHEATVEYLADLVKEKKHLTLFPHMFSNVERLLDDEIGRVRVALFQTEFPRVELPEPAG |
| Female germline-specific tumor suppressor gld-1 | D | 60 | Caenorhabditis Elegans | GSHEATVEYLADLVKEKKHLTLFPHMFSNVERLLDDEIGRVRVALFQTEFPRVELPEPAG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2009-10-09 Deposition Author(s): Beuck, C. , Carmel, A.B. , Columbus, L. , Kerkow, D.E. , Stanfield, R.L. , Szymczyna, B.R. , Williamson, J.R.