Crystal structure of the e. coli thim riboswitch in complex with thiamine pyrophosphate and the u1a crystallization module
PDB DOI: 10.2210/pdb3k0j/pdb
Classification: RNA/RNA BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-09-24 Deposition Author(s): Edwards, T.E. , Ferre-D'Amare, A.R. , Kulshina, N.
Crystal structure of the e. coli thim riboswitch in complex with thiamine pyrophosphate and the u1a crystallization module
Edwards, T.E. , Ferre-D'Amare, A.R. , Kulshina, N.
Primary Citation of Related Structures: 3K0J
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
U1 small nuclear ribonucleoprotein A | A | 96 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM |
U1 small nuclear ribonucleoprotein A | B | 96 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM |
U1 small nuclear ribonucleoprotein A | C | 96 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM |
U1 small nuclear ribonucleoprotein A | D | 96 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-09-24 Deposition Author(s): Edwards, T.E. , Ferre-D'Amare, A.R. , Kulshina, N.