Human mdm2 liganded with a 12mer peptide inhibitor (pdiq)
PDB DOI: 10.2210/pdb3jzs/pdb
Classification: LIGASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-09-24 Deposition Author(s): Phan, J. , Schonbrunn, E.
Human mdm2 liganded with a 12mer peptide inhibitor (pdiq)
Primary Citation of Related Structures: 3JZS
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase Mdm2 | A | 86 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVV |
pDIQ peptide (12mer) | P | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ETFEHWWSQLLS |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-09-24 Deposition Author(s): Phan, J. , Schonbrunn, E.