Crystal structure of bacillus anthracis (y102f) dihydrofolate reductase complexed with nadph and 2,4-diamino-5-(3-(3,4,5-trimethoxyphenyl)prop-1-ynyl)-6-ethylpyrimidine (ucp120a)
PDB DOI: 10.2210/pdb3jwc/pdb
Classification: OXIDOREDUCTASE/OXIDOREDUCTASE INHIBITOR Organism(s): Bacillus Anthracis
Deposited: 2009-09-18 Deposition Author(s): Anderson, A.C. , Beierlein, J.M. , Karri, N.G.
Crystal structure of bacillus anthracis (y102f) dihydrofolate reductase complexed with nadph and 2,4-diamino-5-(3-(3,4,5-trimethoxyphenyl)prop-1-ynyl)-6-ethylpyrimidine (ucp120a)
Anderson, A.C. , Beierlein, J.M. , Karri, N.G.
Primary Citation of Related Structures: 3JWC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dihydrofolate reductase | A | 168 | Bacillus Anthracis | HHHHHHMRVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIFDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ |
| Dihydrofolate reductase | B | 168 | Bacillus Anthracis | HHHHHHMRVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIFDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-09-18 Deposition Author(s): Anderson, A.C. , Beierlein, J.M. , Karri, N.G.