3JTI
Crystal structure of the complex formed between phospholipase a2 with beta-amyloid fragment, lys-gly-ala-ile-ile-gly-leu-met at 1.8 a resolution
PDB DOI: 10.2210/pdb3jti/pdb
Classification: HYDROLASE Organism(s): Sparus Aurata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-09-12 Deposition Author(s): Bhushan, A. , Kaur, P. , Mirza, Z. , Pandey, N. , Sharma, S. , Singh, N. , Singh, T.P. , Srinivasan, A. , Vikram, G.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Crystal structure of the complex formed between phospholipase a2 with beta-amyloid fragment, lys-gly-ala-ile-ile-gly-leu-met at 1.8 a resolution
Bhushan, A. , Kaur, P. , Mirza, Z. , Pandey, N. , Sharma, S. , Singh, N. , Singh, T.P. , Srinivasan, A. , Vikram, G.
Primary Citation of Related Structures: 3JTI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phospholipase A2 isoform 3 | A | 119 | Sparus Aurata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NLYQFKNMIQCTVPSRSWADFADYGCYCGKGGSGTPVDDLDRCCQTHDNCYNEAENISGCRPYFKTYSYECTQGTLTCKGDNNACAASVCDCDRLAAICFAGAPYNDANYNIDLKARCN |
| octapeptide from Amyloid beta A4 protein | B | 8 | Sparus Aurata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KGAIIGLM |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2009-09-12 Deposition Author(s): Bhushan, A. , Kaur, P. , Mirza, Z. , Pandey, N. , Sharma, S. , Singh, N. , Singh, T.P. , Srinivasan, A. , Vikram, G.