Crystal structure of mouse elf3 c-terminal dna-binding domain in complex with type ii tgf-beta receptor promoter dna
PDB DOI: 10.2210/pdb3jtg/pdb
Classification: TRANSCRIPTION Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-09-11 Deposition Author(s): Agarkar, V.B. , Babayeva, N.D. , Rizzino, A. , Tahirov, T.H.
Crystal structure of mouse elf3 c-terminal dna-binding domain in complex with type ii tgf-beta receptor promoter dna
Agarkar, V.B. , Babayeva, N.D. , Rizzino, A. , Tahirov, T.H.
Primary Citation of Related Structures: 3JTG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
ETS-related transcription factor Elf-3 | A | 103 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | APRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVGESRN |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-09-11 Deposition Author(s): Agarkar, V.B. , Babayeva, N.D. , Rizzino, A. , Tahirov, T.H.