3JQL
Crystal structure of the complex formed between phospholipase a2 and a hexapeptide fragment of amyloid beta peptide, lys-leu-val-phe-phe-ala at 1.2 a resolution
PDB DOI: 10.2210/pdb3jql/pdb
Classification: HYDROLASE Organism(s): Sparus Aurata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-09-07 Deposition Author(s): Kaur, P. , Mirza, Z. , Sharma, S. , Singh, N. , Singh, T.P. , Sinha, M. , Srinivasan, A. , Vikram, G.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.2 Å
Crystal structure of the complex formed between phospholipase a2 and a hexapeptide fragment of amyloid beta peptide, lys-leu-val-phe-phe-ala at 1.2 a resolution
Kaur, P. , Mirza, Z. , Sharma, S. , Singh, N. , Singh, T.P. , Sinha, M. , Srinivasan, A. , Vikram, G.
Primary Citation of Related Structures: 3JQL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Acidic phospholipase A2 3 (Fragment) | A | 119 | Sparus Aurata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NLYQFKNMIQCTVPSRSWADFADYGCYCGKGGSGTPVDDLDRCCQTHDNCYNEAENISGCRPYFKTYSYECTQGTLTCKGDNNACAASVCDCDRLAAICFAGAPYNDANYNIDLKARCN |
| Amyloid Beta Peptide | B | 6 | Sparus Aurata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KLVFFA |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2009-09-07 Deposition Author(s): Kaur, P. , Mirza, Z. , Sharma, S. , Singh, N. , Singh, T.P. , Sinha, M. , Srinivasan, A. , Vikram, G.