The crystal structure of cruzain in complex with a tetrafluorophenoxymethyl ketone inhibitor
PDB DOI: 10.2210/pdb3iut/pdb
Classification: HYDROLASE Organism(s): Trypanosoma Cruzi
Deposited: 2009-08-31 Deposition Author(s): Brinen, L.S. , Debnath, M. , Kerr, I.D.
The crystal structure of cruzain in complex with a tetrafluorophenoxymethyl ketone inhibitor
Brinen, L.S. , Debnath, M. , Kerr, I.D.
Primary Citation of Related Structures: 3IUT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cruzipain | A | 221 | Trypanosoma Cruzi | APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLAEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDGAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVGHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-08-31 Deposition Author(s): Brinen, L.S. , Debnath, M. , Kerr, I.D.