Crystal structure of human insulin with ni+2 complex
PDB DOI: 10.2210/pdb3inc/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2009-08-12 Deposition Author(s): Pattabhi, V. , Raghavendra, N. , Rajan, S.S.
Crystal structure of human insulin with ni+2 complex
Pattabhi, V. , Raghavendra, N. , Rajan, S.S.
Primary Citation of Related Structures: 3INC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin A chain | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin A chain | C | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin B chain | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Insulin B chain | D | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-08-12 Deposition Author(s): Pattabhi, V. , Raghavendra, N. , Rajan, S.S.