Crystal structure of camp-dependent protein kinase a regulatory subunit i alpha in complex with dual-specific a-kinase anchoring protein 2
PDB DOI: 10.2210/pdb3im4/pdb
Classification: STRUCTURAL PROTEIN, SIGNALING PROTEIN Organism(s): Parengyodontium Album , Salmonella Enterica
Deposited: 2009-08-09 Deposition Author(s): Kim, C. , Kinderman, F.S. , Sarma, G.N. , Taylor, S.S. , Von Daake, S.
Method: X-RAY DIFFRACTION Resolution: 2.285 Å
Crystal structure of camp-dependent protein kinase a regulatory subunit i alpha in complex with dual-specific a-kinase anchoring protein 2
Kim, C. , Kinderman, F.S. , Sarma, G.N. , Taylor, S.S. , Von Daake, S.
Primary Citation of Related Structures: 3IM4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
cAMP-dependent protein kinase type I-alpha regulatory subunit | A | 50 | Parengyodontium Album , Salmonella Enterica | SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK |
cAMP-dependent protein kinase type I-alpha regulatory subunit | B | 50 | Parengyodontium Album , Salmonella Enterica | SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK |
Dual specificity A kinase-anchoring protein 2 | C | 45 | Parengyodontium Album , Salmonella Enterica | GSPEFVQGNTDEAQEELAWKIAKMIVSDVMQQAQYDQPLEKSTKL |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-08-09 Deposition Author(s): Kim, C. , Kinderman, F.S. , Sarma, G.N. , Taylor, S.S. , Von Daake, S.