3IDW
Crystal structure of sla1 homology domain 2
PDB DOI: 10.2210/pdb3idw/pdb
Classification: ENDOCYTOSIS Organism(s): Saccharomyces Cerevisiae
Deposited: 2009-07-21 Deposition Author(s): Bowie, J.U. , Cascio, D. , Di Pietro, S.M. , Payne, G.S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.85 Å
Crystal structure of sla1 homology domain 2
Bowie, J.U. , Cascio, D. , Di Pietro, S.M. , Payne, G.S.
Primary Citation of Related Structures: 3IDW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Actin cytoskeleton-regulatory complex protein SLA1 | A | 72 | Saccharomyces Cerevisiae | NKYDWFEFFLNCGVDVSNCQRYTINFDREQLTEDMMPDINNSMLRTLGLREGDIVRVMKHLDKKFGRENIAS |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2009-07-21 Deposition Author(s): Bowie, J.U. , Cascio, D. , Di Pietro, S.M. , Payne, G.S.