Structure of cold shock protein e from salmonella typhimurium
PDB DOI: 10.2210/pdb3i2z/pdb
Classification: GENE REGULATION Organism(s): Salmonella Typhimurium
Deposited: 2009-06-30 Deposition Author(s): Gallagher, M. , Mcnae, I. , Morgan, H.P. , Walkinshaw, M.D. , Wear, M.A.
Structure of cold shock protein e from salmonella typhimurium
Gallagher, M. , Mcnae, I. , Morgan, H.P. , Walkinshaw, M.D. , Wear, M.A.
Primary Citation of Related Structures: 3I2Z
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
RNA chaperone, negative regulator of cspA transcription | B | 71 | Salmonella Typhimurium | SHMSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVTAL |
RNA chaperone, negative regulator of cspA transcription | A | 71 | Salmonella Typhimurium | SHMSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVTAL |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-06-30 Deposition Author(s): Gallagher, M. , Mcnae, I. , Morgan, H.P. , Walkinshaw, M.D. , Wear, M.A.