Crystal structure of a gcn4 leucine zipper mutant at 1.6 a resolution
PDB DOI: 10.2210/pdb3i1g/pdb
Classification: METAL BINDING PROTEIN Organism(s): N.A.
Deposited: 2009-06-26 Deposition Author(s): Diao, J.S. , Tortajada, A. , Yeh, J.I.
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Crystal structure of a gcn4 leucine zipper mutant at 1.6 a resolution
Diao, J.S. , Tortajada, A. , Yeh, J.I.
Primary Citation of Related Structures: 3I1G
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| General control protein GCN4 | A | 33 | N.A. | RMAQLEAKVEELLSKNWNLENEVARLKKLVGER |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-06-26 Deposition Author(s): Diao, J.S. , Tortajada, A. , Yeh, J.I.