Crystal structure of the ggdef domain of the pa2567 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par365c
PDB DOI: 10.2210/pdb3hvw/pdb
Classification: LYASE Organism(s): Pseudomonas Aeruginosa
Deposited: 2009-06-16 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Foote, E.L. , Forouhar, F. , Hunt, J.F. , Lew, S. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Sahdev, S. , Seetharaman, J. , Tong, L. , Wang, H. , Xiao, R.
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Crystal structure of the ggdef domain of the pa2567 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par365c
Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Foote, E.L. , Forouhar, F. , Hunt, J.F. , Lew, S. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Sahdev, S. , Seetharaman, J. , Tong, L. , Wang, H. , Xiao, R.
Primary Citation of Related Structures: 3HVW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Diguanylate-cyclase (DGC) | A | 176 | Pseudomonas Aeruginosa | MIDEPTGLYNRLRLQEDVSLRLQRDGALTVIAADLLPLALLNTIIRTLGYPFSNDLMLEARDRIRAELPDFTLYKISPTRFGLLLPRQQQEETESVCLRLLRAFESPVVCRGIPIKANVGLGVLPLADDTLDGDQDWLRLVVSAADDARDRGVGWARYNPPLDQAQQRLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-06-16 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Foote, E.L. , Forouhar, F. , Hunt, J.F. , Lew, S. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Sahdev, S. , Seetharaman, J. , Tong, L. , Wang, H. , Xiao, R.