Crystal structure of a c-terminal coiled coil domain of transient receptor potential (trp) channel subfamily p member 2 (trpp2, polycystic kidney disease 2)
PDB DOI: 10.2210/pdb3hro/pdb
Classification: TRANSPORT PROTEIN Organism(s): Homo Sapiens
Deposited: 2009-06-09 Deposition Author(s): Buraei, Z. , Chen, X.-Z. , Isacoff, E.Y. , Li, M.-H. , Ong, A.C.M. , Tong, L. , Ulbrich, M.H. , Yang, J. , Yu, Y.
Crystal structure of a c-terminal coiled coil domain of transient receptor potential (trp) channel subfamily p member 2 (trpp2, polycystic kidney disease 2)
Buraei, Z. , Chen, X.-Z. , Isacoff, E.Y. , Li, M.-H. , Ong, A.C.M. , Tong, L. , Ulbrich, M.H. , Yang, J. , Yu, Y.
Primary Citation of Related Structures: 3HRO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transient receptor potential (TRP) channel subfamily P member 2 (TRPP2), also called Polycystin-2 or polycystic kidney disease 2(PKD2) | A | 44 | Homo Sapiens | GSHMGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMER |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-06-09 Deposition Author(s): Buraei, Z. , Chen, X.-Z. , Isacoff, E.Y. , Li, M.-H. , Ong, A.C.M. , Tong, L. , Ulbrich, M.H. , Yang, J. , Yu, Y.